Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: O75417
RecName: DNA polymerase theta
Begin-End: 2096-2584
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TAECESQKHIMQAKLDAIETQAYQLAGHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSK
KTLGSTRRGIDNGRKLRLGRQFSTSKDVLNKLKALHPLPGLILEWRRITNAITKVVFPLQ
REKCLNPFLGMERIYPVSQSHTATGRITFTEPNIQNVPRDFEIKMPTLVGESPPSQAVGK
GLLPMGRGKYKKGFSVNPRCQAQMEERAADRGMPFSISMRHAFVPFPGGSILAADYSQLE
LRILAHLSHDRRLIQVLNTGADVFRSIAAEWKMIEPESVGDDLRQQAKQICYGIIYGMGA
KSLGEQMGIKENDAACYIDSFKSRYTGINQFMTETVKNCKRDGFVQTILGRRRYLPGIKD
NNPYRKAHAERQAINTIVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQSDQTG
LSRKRKLQGMFCPIRGGFFILQLHDELLYEVAEEDVVQVAQIVKNEMESAVKLSVKLKVK
VKIGASWGE
Structures of the domain O75417 2096-2584
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4x0p X-ray 3.91 A 2096-2584  H-Bb H-Mn L-Bb L-Mn 
4x0p X-ray 3.91 B 2096-2584  H-Bb H-Mn L-Bb L-Mn 
4x0p X-ray 3.91 C 2096-2584  H-Bb H-Mn L-Bb L-Mn 
4x0p X-ray 3.91 D 2096-2584  H-Bb L-Bb L-Mn 
4x0q X-ray 3.9 A 2096-2584  H-Bb H-Mn L-Bb L-Mn 
4x0q X-ray 3.9 B 2096-2584  H-Bb H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text