Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: O77395
RecName: 40S ribosomal protein S15A, putative
Begin-End: 5-130
Organism: Plasmodium falciparum (isolate 3D7)
Interaction Mode:   

Sequence:
SVLADCLKTINNAEKRGRRQVLIRPSSKVVIKFLQYMQKKGYIGSFEIVDDHRSGKIVVN
LLGRINKCAVISPRYDVKLDEIEKIITSILPSRLFGHLILTTPYGIMDHEEARRKHTGGK
VLGFFF
Structures of the domain O77395 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6okk X-ray 3.3 K 5-130 None
3j7a X-ray 3.2 K 5-130 None


© NPIDB team 2003 - 2021

text