Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: O77448
RecName: Telomerase reverse transcriptase
Begin-End: 715-881
Organism: Tetrahymena thermophila
Interaction Mode:   

Sequence:
LQKGFKEIQSDDRPFIVINQDKPRCITKDIIHNHLKHISQYNVISFNKVKFRQKRGIPQG
LNISGVLCSFYFGKLEEEYTQFLKNAEQVNGSINLLMRLTDDYLFISDSQQNALNLIVQL
QNCANNNGFMFNDQKITTNFQFPQEDYNLEHFKISVQNECQWIGKSI
Structures of the domain O77448 715-881
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6d6v X-ray 4.8 A 715-881 None
6d6v X-ray 4.8 A 536-697 None


© NPIDB team 2003 - 2021

text