Pfam domain
Pfam family: Fapy_DNA_glyco (PF01149.26)
Uniprot AC: O80358
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 2-131
Organism: Arabidopsis thaliana
Interaction Mode:  S-Bb L-Bb L-Mj L-Mn 

Sequence:
PELPEVEAARRAIEENCLGKKIKRVIIADDNKVIHGISPSDFQTSILGKTIISARRKGKN
LWLELDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVKDSEEWPSKYSKFFVELDDGLELS
FTDKRRFAKV
Structures of the domain O80358 2-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3twm X-ray 2.8 B 2-131  S-Bb L-Bb L-Mj L-Mn 
3twm X-ray 2.8 A 2-131  S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text