Pfam domain
Pfam family: SAD_SRA (PF02182.19)
Uniprot AC: O82175
RecName: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5
Begin-End: 363-519
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
IIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDN
SDVLIYTGQGGNVGKKKNNEPPKDQQLVTGNLALKNSINKKNPVRVIRGIKNTTLQSSVV
AKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQ
Structures of the domain O82175 363-519
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3q0b X-ray 2.2 X 363-519 None
4ygi X-ray 2.6 A 363-519 None
3q0c X-ray 2.66 X 363-519 None
3q0c X-ray 2.66 A 363-519 None
3q0f X-ray 2.75 A 363-519  H-Bb S-Bb L-Bb L-Mn 
3q0f X-ray 2.75 X 363-519  H-Bb S-Bb L-Bb L-Mj 
3q0d X-ray 2.37 A 363-519 None
3q0d X-ray 2.37 X 363-519 None


© NPIDB team 2003 - 2021

text