Pfam domain
Pfam family: RHD_dimer (PF16179.7)
Uniprot AC: O94916
RecName: Nuclear factor of activated T-cells 5
Begin-End: 446-544
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLI
VKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPD
Structures of the domain O94916 446-544
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1imh X-ray 2.86 D 370-468 None
1imh X-ray 2.86 C 370-468  S-Bb 


© NPIDB team 2003 - 2021

text