Pfam domain
Pfam family: SET (PF00856.30)
Uniprot AC: O96028
RecName: Histone-lysine N-methyltransferase NSD2
Begin-End: 1074-1180
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPK
GNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYN
Structures of the domain O96028 1074-1180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7cro X-ray 3.75 I 1074-1180 None


© NPIDB team 2003 - 2021

text