Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: O97248
RecName: 40S ribosomal protein S23, putative
Begin-End: 31-144
Organism: Plasmodium falciparum (isolate 3D7)
Interaction Mode:   

Sequence:
KSHLGTRWKSNPFRGSSHAKGIVVEKVAIEAKQPNSAYRKCVRVQLIKNGKKITAFVPGD
GCLNFIDENDEVLVSGFGRSGHSVGDLPGVKFKVVKVARVSLLALFKEKKEKPR
Structures of the domain O97248 31-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6okk X-ray 3.3 Q 31-144 None
3j7a X-ray 3.2 Q 31-144 None


© NPIDB team 2003 - 2021

text