Pfam domain
Pfam family: RNA_pol (PF00940.21)
Uniprot AC: P00573
RecName: T7 RNA polymerase
Begin-End: 450-883
Organism: Enterobacteria phage T7
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb S-Mj L-Bb L-Mj 

Sequence:
KPIGKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSPLENTWWAEQDSPF
CFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSETVQD
IYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSV
TKRSVMTLAYGSKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTV
VAAVEAMNWLKSAAKLLAAEVKDKKTGEILRKRCAVHWVTPDGFPVWQEYKKPIQTRLNL
MFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHEKYGIESFAL
IHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGN
LNLRDILESDFAFA
Structures of the domain P00573 450-883
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pi5 X-ray 2.9 A 450-883  S-Bb S-Mj L-Bb L-Mj 
1qln X-ray 2.4 A 450-883  S-Bb S-Mj L-Bb L-Mj 
1s76 X-ray 2.88 D 450-883 None
1cez X-ray 2.4 A 450-883  S-Bb S-Mj L-Bb L-Mj 
3e2e X-ray 3 A 450-883  H-Bb H-Mj H-Mn S-Bb S-Mj L-Bb L-Mj 
3e3j X-ray 6.7 C 450-883  H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
3e3j X-ray 6.7 B 450-883  H-Mj H-Mn S-Bb S-Mj L-Bb L-Mj 
2pi4 X-ray 2.5 A 450-883  S-Bb S-Mj L-Bb L-Mj 
1msw X-ray 2.1 D 450-883 None
1s77 X-ray 2.69 D 450-883 None
1h38 X-ray 2.9 A 450-883  H-Bb H-Mj H-Mn 
1h38 X-ray 2.9 B 450-883  H-Bb H-Mj H-Mn 
1h38 X-ray 2.9 C 450-883  H-Bb H-Mj H-Mn 
1h38 X-ray 2.9 D 450-883  H-Bb H-Mj H-Mn L-Bb 
1s0v X-ray 3.2 A 450-883  H-Bb H-Mj H-Mn 
1s0v X-ray 3.2 D 450-883  H-Bb H-Mj H-Mn L-Mj 
1s0v X-ray 3.2 C 450-883  H-Bb H-Mj H-Mn L-Bb 
1s0v X-ray 3.2 B 450-883  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text