Pfam domain
Pfam family: Sigma70_ner (PF04546.15)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 137-348
Organism: Escherichia coli
Interaction Mode:   

Sequence:
YPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATHVGSELSQEDLDDDEDE
DEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVF
KQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWF
NAAIAMNKPWSEKLHDVSEEVHRALQKLQQIE
Structures of the domain P00579 137-348
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ylp X-ray 5.5 F 137-348 None
4ylp X-ray 5.5 L 137-348 None
4ylp X-ray 5.5 R 137-348 None
3iyd X-ray 19.8 F 137-348 None
6ldi X-ray 3.69 F 152-348 None
7c17 X-ray 4.22 F 152-348 None
6pb5 X-ray 4.52 F 137-348 None
4yln X-ray 5.5 F 137-348 None
4yln X-ray 5.5 L 137-348 None
4yln X-ray 5.5 R 137-348 None
4ylo X-ray 6 F 137-348 None
4ylo X-ray 6 L 137-348 None
4ylo X-ray 6 R 137-348 None
6b6h X-ray 3.9 F 137-348 None
6psr X-ray 3.4 L 213-348 None
6psq X-ray 3.4 L 213-348 None
6n4c X-ray 17 F 137-348 None
6pb6 X-ray 4.29 F 137-348 None
6pb4 X-ray 4.35 F 137-348 None


© NPIDB team 2003 - 2021

text