Pfam domain
Pfam family: Sigma70_r1_1 (PF03979.16)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 2-79
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAPD
ADDLMLAENTADEDAAEA
Structures of the domain P00579 2-79
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrd X-ray 3.62 F 6-83 None
7khi X-ray 3.62 F 6-83 None


© NPIDB team 2003 - 2021

text