Pfam domain
Pfam family: Sigma70_r2 (PF04542.16)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 215-285
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ELAREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMR
VMMDRVRTQER
Structures of the domain P00579 215-285
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wr6 X-ray 4.14 F 379-449  H-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text