Pfam domain
Pfam family: Sigma70_r2 (PF04542.16)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 239-309
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMP
KKNFITLFTGN
Structures of the domain P00579 239-309
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrg X-ray 3.58 F 379-449  H-Bb H-Mj H-Mn 
6wr8 X-ray 3.53 F 379-449  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text