Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 294-371
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QCKMPKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGL
TIEQVKDINRRMSIGEAK
Structures of the domain P00579 294-371
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wr6 X-ray 4.14 F 458-535 None


© NPIDB team 2003 - 2021

text