Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 318-395
Organism: Escherichia coli
Interaction Mode:   

Sequence:
AAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKK
EMVEANLRLVISIAKKYT
Structures of the domain P00579 318-395
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrg X-ray 3.58 F 458-535  H-Bb 
6wr8 X-ray 3.53 F 458-535 None


© NPIDB team 2003 - 2021

text