Pfam domain
Pfam family: Sigma70_r2 (PF04542.16)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 379-449
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQA
ITRSIADQART
Structures of the domain P00579 379-449
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vt0 X-ray 3.78 L 379-449 None
4ylp X-ray 5.5 F 379-449 None
4ylp X-ray 5.5 L 379-449 None
4ylp X-ray 5.5 R 379-449 None
3iyd X-ray 19.8 F 379-449 None
6ldi X-ray 3.69 F 379-449  H-Bb H-Mj H-Mn 
7c17 X-ray 4.22 F 379-449  H-Bb H-Mj H-Mn 
6pb5 X-ray 4.52 F 379-449  H-Bb H-Mj 
7khe X-ray 3.58 F 379-449  H-Bb H-Mj H-Mn 
6k4y X-ray 3.79 F 379-449  H-Bb H-Mj H-Mn 
6psu X-ray 3.9 L 379-449  H-Bb H-Mj H-Mn 
6psv X-ray 3.5 L 379-449  H-Bb H-Mj H-Mn 
6psw X-ray 3.7 L 379-449  H-Bb H-Mj H-Mn 
4yln X-ray 5.5 F 379-449 None
4yln X-ray 5.5 L 379-449 None
4yln X-ray 5.5 R 379-449 None
6p18 X-ray 3.5 F 379-449  H-Bb H-Mj H-Mn 
6ca0 X-ray 5.75 F 379-449  H-Bb H-Mj H-Mn 
4ylo X-ray 6 F 379-449 None
4ylo X-ray 6 L 379-449 None
4ylo X-ray 6 R 379-449 None
6pst X-ray 3 L 379-449  H-Bb H-Mj H-Mn 
6b6h X-ray 3.9 F 379-449  H-Bb H-Mj 
7khi X-ray 3.62 F 379-449  H-Bb H-Mj H-Mn 
6jnx X-ray 4.08 F 379-447  H-Bb H-Mj H-Mn 
7c97 X-ray 3.68 F 379-449  H-Bb 
6pss X-ray 3.5 L 379-449  H-Mj H-Mn L-Bb L-Mj 
6oul X-ray 3.4 L 379-449  H-Bb H-Mj H-Mn L-Bb 
6psr X-ray 3.4 L 379-449  H-Mj 
6psq X-ray 3.4 L 379-449  H-Bb 
6n4c X-ray 17 F 379-449 None
7chw X-ray 3.58 F 379-449 None
7khc X-ray 4.14 F 379-449  H-Bb L-Bb L-Mj 
6pb6 X-ray 4.29 F 379-449 None
7khb X-ray 3.53 F 379-449  H-Bb H-Mj H-Mn 
6pb4 X-ray 4.35 F 379-449  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text