Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 407-460
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETI
Structures of the domain P00579 407-460
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrg X-ray 3.58 F 547-600  H-Bb H-Mj 
6wr8 X-ray 3.53 F 547-600  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text