Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 458-535
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDS
HLGDFIEDTTLELPLDSA
Structures of the domain P00579 458-535
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vt0 X-ray 3.78 L 458-533 None
4ylp X-ray 5.5 F 458-533 None
4ylp X-ray 5.5 L 458-533 None
4ylp X-ray 5.5 R 458-533 None
3iyd X-ray 19.8 F 458-533 None
6ldi X-ray 3.69 F 458-533 None
7c17 X-ray 4.22 F 458-533  H-Bb 
6pb5 X-ray 4.52 F 458-533  H-Bb 
7khe X-ray 3.58 F 458-533  H-Bb 
6k4y X-ray 3.79 F 458-531  H-Bb 
6psu X-ray 3.9 L 458-533 None
6psv X-ray 3.5 L 458-533 None
6psw X-ray 3.7 L 458-533 None
4yln X-ray 5.5 F 458-533 None
4yln X-ray 5.5 L 458-533 None
4yln X-ray 5.5 R 458-533 None
6ca0 X-ray 5.75 F 458-533 None
4ylo X-ray 6 F 458-533 None
4ylo X-ray 6 L 458-533 None
4ylo X-ray 6 R 458-533 None
6pst X-ray 3 L 458-533 None
6b6h X-ray 3.9 F 458-533  H-Bb 
7khi X-ray 3.62 F 458-533  H-Bb 
7c97 X-ray 3.68 F 458-533 None
6pss X-ray 3.5 L 458-533 None
6oul X-ray 3.4 L 458-533  H-Bb 
6psr X-ray 3.4 L 458-533 None
6psq X-ray 3.4 L 458-533  H-Bb 
6n4c X-ray 17 F 458-537 None
7chw X-ray 3.58 F 458-533 None
7khc X-ray 4.14 F 458-533 None
6pb6 X-ray 4.29 F 458-533 None
7khb X-ray 3.53 F 458-533  H-Bb 
6pb4 X-ray 4.35 F 458-533  H-Bb 


© NPIDB team 2003 - 2021

text