Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 492-545
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRAATH
Structures of the domain P00579 492-545
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrd X-ray 3.62 F 547-600  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text