Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 547-600
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
Structures of the domain P00579 547-600
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vt0 X-ray 3.78 L 547-600 None
4ylp X-ray 5.5 F 547-600 None
4ylp X-ray 5.5 L 547-600 None
4ylp X-ray 5.5 R 547-600 None
3iyd X-ray 19.8 F 547-600  H-Bb H-Mj L-Bb L-Mj 
6ldi X-ray 3.69 F 547-600  H-Bb H-Mj L-Bb L-Mj 
7c17 X-ray 4.22 F 547-600  H-Bb H-Mj L-Bb 
6pb5 X-ray 4.52 F 547-600 None
7khe X-ray 3.58 F 547-600  H-Bb H-Mj 
6k4y X-ray 3.79 F 547-600 None
6psu X-ray 3.9 L 547-600  H-Bb H-Mj L-Bb L-Mj 
6psv X-ray 3.5 L 547-600  H-Bb H-Mj L-Bb 
6psw X-ray 3.7 L 547-600  H-Bb H-Mj L-Bb L-Mj 
4yln X-ray 5.5 F 547-600 None
4yln X-ray 5.5 L 547-600 None
4yln X-ray 5.5 R 547-600 None
6ca0 X-ray 5.75 F 547-600  H-Bb H-Mj 
3t72 X-ray 4.33 o 16-600 None
3t72 X-ray 4.33 q 547-600 None
4ylo X-ray 6 F 547-600 None
4ylo X-ray 6 L 547-600 None
4ylo X-ray 6 R 547-600 None
6pst X-ray 3 L 547-600  H-Bb H-Mj L-Bb L-Mj 
6b6h X-ray 3.9 F 547-600  H-Bb H-Mj L-Bb L-Mj 
7khi X-ray 3.62 F 547-600  H-Bb H-Mj L-Bb 
7c97 X-ray 3.68 F 547-600  H-Bb H-Mj L-Bb L-Mj 
6pss X-ray 3.5 L 547-600  H-Bb H-Mj L-Bb L-Mj 
6oul X-ray 3.4 L 547-600  H-Bb H-Mj L-Mj 
6psr X-ray 3.4 L 547-600  H-Bb H-Mj L-Bb L-Mj 
6psq X-ray 3.4 L 547-600  H-Bb H-Mj L-Bb L-Mj 
6n4c X-ray 17 F 547-600  H-Bb H-Mj L-Mj 
7chw X-ray 3.58 F 547-600  H-Bb H-Mj L-Bb L-Mj 
7khc X-ray 4.14 F 547-600  H-Bb H-Mj L-Bb L-Mj 
6pb6 X-ray 4.29 F 547-600  H-Bb L-Bb 
7khb X-ray 3.53 F 547-600  H-Bb H-Mj 
6pb4 X-ray 4.35 F 547-600  H-Bb 


© NPIDB team 2003 - 2021

text