Pfam domain
Pfam family: Sigma70_r1_2 (PF00140.22)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 7-40
Organism: Escherichia coli
Interaction Mode:   

Sequence:
SQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQ
Structures of the domain P00579 7-40
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wrg X-ray 3.58 F 96-129 None
6wr8 X-ray 3.53 F 96-129 None


© NPIDB team 2003 - 2021

text