Pfam domain
Pfam family: Sigma70_r1_1 (PF03979.16)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 8-83
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAPDADDLML
AENTADEDAAEAAAQV
Structures of the domain P00579 8-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6psu X-ray 3.9 L 7-80 None
6pst X-ray 3 L 7-79 None
7khi X-ray 3.62 F 6-79 None
6pss X-ray 3.5 L 7-79 None
6psr X-ray 3.4 L 7-79 None
6psq X-ray 3.4 L 7-78 None
6n4c X-ray 17 F 8-79 None


© NPIDB team 2003 - 2021

text