Pfam domain
Pfam family: Sigma70_r1_2 (PF00140.22)
Uniprot AC: P00579
RecName: RNA polymerase sigma factor RpoD
Begin-End: 96-128
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DPVRMYMREMGTVELLTREGEIDIAKRIEDGIN
Structures of the domain P00579 96-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vt0 X-ray 3.78 L 96-126 None
4ylp X-ray 5.5 F 96-126 None
4ylp X-ray 5.5 L 96-126 None
4ylp X-ray 5.5 R 96-126 None
6ldi X-ray 3.69 F 96-126 None
7c17 X-ray 4.22 F 96-126 None
6pb5 X-ray 4.52 F 96-126 None
7khe X-ray 3.58 F 96-126 None
6k4y X-ray 3.79 F 96-126 None
6psu X-ray 3.9 L 96-126 None
6psv X-ray 3.5 L 96-126 None
6psw X-ray 3.7 L 96-126 None
4yln X-ray 5.5 F 96-126 None
4yln X-ray 5.5 L 96-126 None
4yln X-ray 5.5 R 96-126 None
6p18 X-ray 3.5 F 96-126 None
6ca0 X-ray 5.75 F 96-126 None
4ylo X-ray 6 F 96-126 None
4ylo X-ray 6 L 96-126 None
4ylo X-ray 6 R 96-126 None
6pst X-ray 3 L 96-126 None
6b6h X-ray 3.9 F 96-126 None
7khi X-ray 3.62 F 96-126 None
6jnx X-ray 4.08 F 96-126 None
7c97 X-ray 3.68 F 96-126 None
6pss X-ray 3.5 L 96-126 None
6oul X-ray 3.4 L 96-126 None
6psr X-ray 3.4 L 96-126 None
6psq X-ray 3.4 L 96-126 None
6n4c X-ray 17 F 96-126 None
7chw X-ray 3.58 F 96-126 None
6pb6 X-ray 4.29 F 96-126 None
7khb X-ray 3.53 F 96-126 None
6pb4 X-ray 4.35 F 96-126 None


© NPIDB team 2003 - 2021

text