Pfam domain
Pfam family: RNase_H_2 (PF13482.8)
Uniprot AC: P00581
RecName: DNA-directed DNA polymerase
Begin-End: 3-181
Organism: Enterobacteria phage T7
Interaction Mode:  L-Bb 

Sequence:
VSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGH
KYDVPALTKLAKLQLNREFHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGS
HALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEEMMDYNVQDVVVTKAL
Structures of the domain P00581 3-181
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1zyq X-ray 2.7 A 2-186  L-Bb 
1tkd X-ray 2.49 A 2-186  L-Bb 
1x9s X-ray 2.7 A 2-186 None
1x9m X-ray 2.1 A 2-186  L-Bb 
1skr X-ray 2.4 A 2-186  L-Bb 
1sks X-ray 2.3 A 2-186  L-Bb 
1skw X-ray 2.3 A 2-186 None
1sl0 X-ray 3.2 A 2-186 None
1sl0 X-ray 3.2 C 2-186 None
1t8e X-ray 2.54 A 2-186  L-Bb 
1tk0 X-ray 2.3 A 2-186  L-Bb 
1tk5 X-ray 2.2 A 2-186  L-Bb 
1tk8 X-ray 2.5 A 2-186  L-Bb 
1x9w X-ray 2.3 A 2-186  L-Bb 
1sl1 X-ray 2.2 A 2-186 None
1sl2 X-ray 2.3 A 2-186  L-Bb 
1t7p X-ray 2.2 A 2-186  L-Bb 


© NPIDB team 2003 - 2021

text