Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: P00581
RecName: DNA-directed DNA polymerase
Begin-End: 316-702
Organism: Enterobacteria phage T7
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
DTREYVAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVD
DPEKQAAIDLIKEYLMIQKRIGQSAEGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFP
NLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAHFMARFDNGE
YAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKF
LENTPAIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQ
SAGALICKLWIIKTEEMLVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQE
AMRWVGDHWNFRCLLDTEGKMGPNWAI
Structures of the domain P00581 316-702
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1zyq X-ray 2.7 A 319-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
1tkd X-ray 2.49 A 312-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
1x9s X-ray 2.7 A 318-702  H-Bb S-Bb L-Bb L-Mj L-Mn 
1x9m X-ray 2.1 A 317-702  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
2ajq X-ray 2.6 F 318-702  H-Bb S-Bb L-Bb L-Mn 
2ajq X-ray 2.6 A 312-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
1skr X-ray 2.4 A 319-702  H-Bb S-Bb L-Bb L-Mn 
1sks X-ray 2.3 A 315-702  H-Bb H-Mj H-Mn L-Bb L-Mn 
1skw X-ray 2.3 A 314-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
1sl0 X-ray 3.2 A 295-702  H-Bb S-Bb L-Bb L-Mn 
1sl0 X-ray 3.2 C 295-701  H-Bb H-Mn S-Bb L-Bb L-Mn 
1t8e X-ray 2.54 A 312-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
1tk0 X-ray 2.3 A 317-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
1tk5 X-ray 2.2 A 314-702  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
1tk8 X-ray 2.5 A 312-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
1x9w X-ray 2.3 A 318-702  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
1sl1 X-ray 2.2 A 318-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
1sl2 X-ray 2.3 A 319-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
1t7p X-ray 2.2 A 319-702  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
6n7w X-ray 4.5 H 312-702  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
6p7e X-ray 3 A 318-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
6p7e X-ray 3 B 317-702  H-Bb H-Mn S-Bb L-Bb L-Mn 
6p7e X-ray 3 C 317-702  L-Bb L-Mn 


© NPIDB team 2003 - 2021

text