Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: P00581
RecName: DNA-directed DNA polymerase
Begin-End: 326-702
Organism: Enterobacteria phage T7
Interaction Mode:   

Sequence:
YTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDL
IKEYLMIQKRIGQSAEGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRS
PYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAHFMARFDNGEYAHEILNGDI
HTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAAL
RESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLW
IIKTEEMLVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWN
FRCLLDTEGKMGPNWAI
Structures of the domain P00581 326-702
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n9v X-ray 4 H 247-702 None
6n9w X-ray 4 H 247-702 None
6n9x X-ray 4.1 H 247-702 None
6n9u X-ray 3.7 H 247-702 None
6p7e X-ray 3 D 247-702  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text