Pfam domain
Pfam family: Phage_endo_I (PF05367.13)
Uniprot AC: P00641
RecName: Endonuclease I
Begin-End: 16-145
Organism: Enterobacteria phage T7
Interaction Mode:   

Sequence:
RSGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFLLPNGIFVETKGLWESDDR
KKHLLIREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEKHGIKFADKLIPAEWIKEPKK
EVPFDRLKRK
Structures of the domain P00641 16-145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pfj X-ray 3.1 B 16-145  H-Bb S-Bb L-Bb L-Mj 
2pfj X-ray 3.1 A 17-145  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text