Pfam domain
Pfam family: NTP_transf_2 (PF01909.25)
Uniprot AC: P00973
RecName: 2'-5'-oligoadenylate synthase 1
Begin-End: 37-140
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRG
EFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQ
Structures of the domain P00973 37-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ig8 X-ray 2.7 A 37-141 None


© NPIDB team 2003 - 2021

text