Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: P01104
RecName: Transforming protein Myb
Begin-End: 10-67
Organism: Avian myeloblastosis virus
Interaction Mode:  H-Bb H-Mj 

Sequence:
RWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKGRIGKQCRERWHNHL
Structures of the domain P01104 10-67
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1h8a X-ray 2.23 C 95-152  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text