Pfam domain
Pfam family: V-set (PF07686.19)
Uniprot AC: P01863
RecName: Ig gamma-2A chain C region, A allele
Begin-End: 6-120
Organism: Mus musculus
Interaction Mode:   

Sequence:
PSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLS
SSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGG
Structures of the domain P01863 6-120
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ehl X-ray 2.4 H 5-112 None
1keg X-ray 2.4 H 5-112 None


© NPIDB team 2003 - 2021

text