Pfam domain
Pfam family: V-set (PF07686.19)
Uniprot AC: P01867
RecName: Ig gamma-2B chain C region
Begin-End: 11-121
Organism: Mus musculus
Interaction Mode:   

Sequence:
APGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVP
SSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
Structures of the domain P01867 11-121
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1cbv X-ray 2.66 H 10-120 None


© NPIDB team 2003 - 2021

text