Pfam domain
Pfam family: V-set (PF07686.19)
Uniprot AC: P01868
RecName: Ig gamma-1 chain C region secreted form
Begin-End: 7-123
Organism: Mus musculus
Interaction Mode:   

Sequence:
SVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSS
SVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPK
Structures of the domain P01868 7-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1r0a X-ray 2.8 H 6-122 None
1n5y X-ray 3.1 H 6-122 None
1n6q X-ray 3 H 6-122 None


© NPIDB team 2003 - 2021

text