Pfam domain
Pfam family: Linker_histone (PF00538.21)
Uniprot AC: P02259
RecName: Histone H5
Begin-End: 26-97
Organism: Gallus gallus
Interaction Mode:  H-Bb L-Mj 

Sequence:
HPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQT
KGVGASGSFRLA
Structures of the domain P02259 26-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wcu X-ray 5.53 V 25-96  H-Bb S-Bb L-Bb 
5wcu X-ray 5.53 U 25-96  H-Bb S-Bb L-Bb L-Mn 
4qlc X-ray 3.5 U 25-96  H-Bb S-Bb S-Mn 
7c0j X-ray 2.75 B 27-97  H-Bb 
7c0j X-ray 2.75 A 27-97  L-Mj 


© NPIDB team 2003 - 2021

text