Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P02281
RecName: Histone H2B 1.1
Begin-End: 33-102
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
SRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITS
REIQTAVRLL
Structures of the domain P02281 33-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wu8 X-ray 2.45 H 28-98 None
4wu8 X-ray 2.45 D 28-98 None
4wu9 X-ray 2.6 H 28-98 None
4wu9 X-ray 2.6 D 28-98 None
6kix X-ray 4.1 H 28-98  H-Bb L-Bb 
6kix X-ray 4.1 D 27-98  H-Bb L-Bb 
3kwq X-ray 3.5 H 30-98  H-Bb S-Bb L-Bb 
3kwq X-ray 3.5 D 30-98  H-Bb L-Bb 
5o9g X-ray 4.8 H 29-98 None
5o9g X-ray 4.8 D 28-98 None
6ryr X-ray 3.1 D 28-98 None
6ryr X-ray 3.1 H 29-98 None
2f8n X-ray 2.9 H 1430-1498  H-Bb H-Mj S-Bb L-Bb 
6fq6 X-ray 4 D 32-98 None
6jyl X-ray 3.37 D 29-98  H-Bb L-Bb 
6jyl X-ray 3.37 H 29-98  H-Bb S-Bb L-Bb 
5onw X-ray 2.8 H 30-98 None
5onw X-ray 2.8 D 26-98 None
3uta X-ray 2.07 H 28-98 None
3uta X-ray 2.07 D 28-98 None
5oy7 X-ray 5.77 L 28-98 None
5oy7 X-ray 5.77 f 29-98 None
5oy7 X-ray 5.77 b 20-90 None
5oy7 X-ray 5.77 D 28-98 None
5oy7 X-ray 5.77 H -622--553 None
5oy7 X-ray 5.77 T 28-98 None
5oy7 X-ray 5.77 X 29-98 None
5oy7 X-ray 5.77 P 29-98 None
5dnm X-ray 2.81 H 28-98 None
5dnm X-ray 2.81 D 28-98 None
5dnn X-ray 2.8 H 28-98 None
5dnn X-ray 2.8 D 28-98 None
6pww X-ray 4.4 J 29-98  H-Bb S-Bb L-Bb 
6pww X-ray 4.4 N 29-98  H-Bb S-Bb L-Bb 
6kw4 X-ray 7.55 P 32-101  H-Bb H-Mj S-Bb L-Bb 
6kw4 X-ray 7.55 T 32-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
2fj7 X-ray 3.2 H 30-98 None
2fj7 X-ray 3.2 D 30-98  H-Bb S-Bb L-Bb 
6ltj X-ray 3.7 H 31-98  H-Bb 
5nl0 X-ray 5.4 N 27-98 None
5nl0 X-ray 5.4 H 27-98 None
5nl0 X-ray 5.4 D 27-98 None
3kxb X-ray 3.2 H 27-98  H-Bb H-Mj 
3kuy X-ray 2.9 H 28-98 None
3kuy X-ray 2.9 D 28-98 None
6px3 X-ray 4.1 H 27-98  H-Bb S-Bb L-Bb 
6px3 X-ray 4.1 D 26-98  H-Bb S-Bb L-Bb L-Mn 
4j8v X-ray 2.58 H 28-98 None
4j8v X-ray 2.58 D 28-98 None
4j8v X-ray 2.58 H 28-98 None
4j8v X-ray 2.58 D 28-98 None
4j8x X-ray 2.87 D 28-98 None
4j8x X-ray 2.87 H 28-98 None
4j8x X-ray 2.87 H 28-98 None
4j8x X-ray 2.87 D 28-98 None
7crp X-ray 3.2 D 27-98  H-Bb L-Bb 
7crp X-ray 3.2 H 25-98  H-Bb S-Bb L-Bb 
5z3u X-ray 4.31 D 29-98  H-Bb S-Bb L-Bb 
5z3u X-ray 4.31 H 29-98  H-Bb L-Bb 
3lel X-ray 2.95 H 27-98 None
3lel X-ray 2.95 R 27-98 None
3lel X-ray 2.95 N 27-98 None
1m1a X-ray 2.65 H 1429-1498  H-Bb H-Mj S-Bb L-Bb 
1m1a X-ray 2.65 D 1229-1298  H-Bb S-Bb L-Bb 
2nzd X-ray 2.65 H 28-98 None
2nzd X-ray 2.65 D 28-98 None
5e5a X-ray 2.81 H 28-98  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 H 1430-1498  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 D 1230-1298  H-Bb S-Bb L-Bb 
3o62 X-ray 3.22 H 28-98  H-Bb L-Bb 
3o62 X-ray 3.22 D 28-98  H-Bb S-Bb L-Bb 
3rei X-ray 2.65 D 28-98 None
3rei X-ray 2.65 H 28-98 None
6ne3 X-ray 3.9 H 29-98  H-Bb S-Bb L-Bb 
5mlu X-ray 2.8 H 28-98 None
5mlu X-ray 2.8 D 29-98 None
6k1p X-ray 3.87 H 29-98  H-Bb L-Bb 
6k1p X-ray 3.87 D 29-98  H-Bb L-Bb 
1s32 X-ray 2.05 H 1425-1498  H-Bb S-Bb L-Bb L-Mn 
1m19 X-ray 2.3 H 1429-1498  H-Bb S-Bb L-Bb 
1m19 X-ray 2.3 D 1229-1298  H-Bb S-Bb L-Bb 
6nog X-ray 3.9 D 32-101  H-Bb L-Bb 
6nog X-ray 3.9 H 32-101  H-Bb L-Bb 
6kiu X-ray 3.2 H 28-98  H-Bb S-Bb L-Bb 
6kiu X-ray 3.2 D 27-98  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 H 29-98  H-Bb S-Bb L-Bb L-Mn 
3tu4 X-ray 3 D 29-98  H-Bb S-Bb L-Bb L-Mn 
3tu4 X-ray 3 H 29-98  H-Bb S-Bb L-Bb L-Mn 
3tu4 X-ray 3 D 29-98  H-Bb S-Bb L-Bb L-Mn 
3reh X-ray 2.5 H 28-98 None
3reh X-ray 2.5 D 28-98 None
5hq2 X-ray 4.5 H 28-98 None
3mvd X-ray 2.9 H 29-98  H-Bb S-Bb L-Bb 
3mvd X-ray 2.9 D 29-98  H-Bb H-Mj S-Bb L-Bb 
6jm9 X-ray 7.3 D 29-98 None
6jm9 X-ray 7.3 H 29-98 None
3utb X-ray 2.2 H 29-98 None
3lz0 X-ray 2.5 H 29-98 None
3lz0 X-ray 2.5 D 28-98 None
6ugm X-ray 3.7 H 29-98  H-Bb S-Bb L-Bb 
6ugm X-ray 3.7 D 29-98  H-Bb L-Bb 
3rej X-ray 2.55 H 29-98 None
3rek X-ray 2.6 H 29-98 None
3rel X-ray 2.7 H 29-98 None
4xzq X-ray 2.4 H 1430-1498  H-Bb S-Bb L-Bb 
4xzq X-ray 2.4 D 1230-1298  H-Bb S-Bb L-Bb 
3lz1 X-ray 2.5 H 29-98 None
3lz1 X-ray 2.5 D 28-98 None
4ld9 X-ray 3.31 H 35-102 None
3ut9 X-ray 2.2 H 26-98 None
3ut9 X-ray 2.2 D 26-98 None
6esi X-ray 6.3 D 31-98 None
6esi X-ray 6.3 H 30-98 None
1m18 X-ray 2.45 H 1429-1498  H-Bb S-Bb L-Bb 
1m18 X-ray 2.45 D 1229-1298  H-Bb H-Mj S-Bb L-Bb 
4kgc X-ray 2.69 H 28-98 None
4kgc X-ray 2.69 D 28-98 None
6ryu X-ray 4 D 28-98 None
6ryu X-ray 4 H 29-98 None
4r8p X-ray 3.28 H 31-101 None
4r8p X-ray 3.28 D 31-101 None
4xuj X-ray 3.18 H 28-98 None
4xuj X-ray 3.18 D 28-98 None
6fq5 X-ray 3.8 H 27-98 None
6fq5 X-ray 3.8 D 27-98 None
6pa7 X-ray 2.94 H 27-98  H-Bb S-Bb L-Bb 
6pa7 X-ray 2.94 D 28-98  H-Bb H-Mj S-Bb L-Bb 
6o96 X-ray 3.5 H 32-101  H-Bb L-Bb 
6o96 X-ray 3.5 D 32-101  H-Bb L-Bb L-Mn 
5f99 X-ray 2.63 H 29-101 None
6kw3 X-ray 7.13 P 32-101  H-Bb L-Bb 
6kw3 X-ray 7.13 T 32-101  H-Bb S-Bb L-Bb 
5z3o X-ray 3.62 H 29-98  H-Bb L-Bb 
5z3o X-ray 3.62 D 29-98  H-Bb S-Bb L-Bb 
5cp6 X-ray 2.6 H 28-98 None
5cp6 X-ray 2.6 D 28-98 None
5omx X-ray 2.32 H 30-101 None
5omx X-ray 2.32 D 32-101 None
5ong X-ray 2.8 H 29-98 None
5ong X-ray 2.8 D 28-98 None
4z66 X-ray 2.5 H 1429-1498  H-Bb S-Bb L-Bb 
4z66 X-ray 2.5 D 1229-1298  H-Bb S-Bb L-Bb 
6r1t X-ray 3.7 H 27-98 None
6r1t X-ray 3.7 D 26-98 None
6x0n X-ray 10 d 25-94 None
6x0n X-ray 10 h 29-98 None
6x0n X-ray 10 H 29-102 None
6x0n X-ray 10 D 25-98 None
6iy3 X-ray 3.67 H 29-101  H-Bb L-Bb L-Mn 
6iy3 X-ray 3.67 D 28-101  H-Bb S-Bb L-Bb 
5xf6 X-ray 2.63 H 28-98 None
5xf6 X-ray 2.63 D 28-98 None
6iro X-ray 3.4 H 29-98  H-Bb S-Bb L-Bb 
6iro X-ray 3.4 D 29-98  H-Bb L-Bb L-Mn 
6pwv X-ray 6.2 N 29-98  H-Bb S-Bb L-Bb 
6pwv X-ray 6.2 J 29-98  H-Bb S-Bb L-Bb 
4zux X-ray 3.82 R 29-98 None
4zux X-ray 3.82 N 5-83 None
4zux X-ray 3.82 H 1-70 None
4zux X-ray 3.82 D 5-80 None
6iy2 X-ray 3.47 H 29-101  H-Bb S-Bb L-Bb 
6uxw X-ray 8.96 Y 29-98  H-Bb L-Bb 
6uxw X-ray 8.96 U 29-98  H-Bb L-Bb 
6r25 X-ray 4.61 D 25-98 None
6i84 X-ray 4.4 W 29-98  H-Bb H-Mj 
6i84 X-ray 4.4 R 28-98  H-Bb H-Mj 
5oxv X-ray 6.72 D 28-98 None
5oxv X-ray 6.72 N 28-98 None
5oxv X-ray 6.72 H 29-98 None
5oxv X-ray 6.72 R 29-98 None
6esh X-ray 5.1 D 31-98 None
1zla X-ray 2.9 H 1430-1498  H-Bb L-Bb 
1zla X-ray 2.9 D 1230-1298  H-Bb S-Bb L-Bb 
6uh5 X-ray 3.5 H 29-98  H-Bb S-Bb L-Bb 
6uh5 X-ray 3.5 D 29-98  H-Bb S-Bb L-Bb 
3mnn X-ray 2.5 H 28-98 None
3mnn X-ray 2.5 D 28-98 None
6nn6 X-ray 3.9 D 32-101 None
6nn6 X-ray 3.9 H 32-101 None
6esf X-ray 3.7 H 28-98 None
6esf X-ray 3.7 D 28-98 None
6ven X-ray 3.37 D 31-101  H-Bb L-Bb 
6ven X-ray 3.37 H 31-101  H-Bb L-Bb 
6r1u X-ray 4.36 D 26-98 None
6kiz X-ray 4.5 H 28-98  H-Bb L-Bb 
6kiz X-ray 4.5 D 27-98  H-Bb L-Bb 
6t9l X-ray 3.6 H 29-98 None
6t9l X-ray 3.6 D 28-98 None
6pwx X-ray 4.2 N 29-98  H-Bb S-Bb L-Bb 
6pwx X-ray 4.2 J 29-98  H-Bb S-Bb L-Bb 
6vyp X-ray 4.99 H 29-98 None
6vyp X-ray 4.99 D 30-98 None
6vyp X-ray 4.99 h 29-98 None
6vyp X-ray 4.99 d 30-97 None
1kx3 X-ray 2 D 29-98 None
1kx3 X-ray 2 H 29-98 None
1kx4 X-ray 2.6 H 29-98 None
1p34 X-ray 2.7 H 1428-1498  H-Bb S-Bb L-Bb 
1p34 X-ray 2.7 D 1230-1298  H-Bb S-Bb L-Bb 
1p3a X-ray 3 H 1431-1498  H-Bb H-Mj S-Bb L-Bb 
1p3a X-ray 3 D 1232-1298  H-Bb S-Bb L-Bb 
1p3b X-ray 3 H 1431-1498  H-Bb S-Bb L-Bb 
1p3b X-ray 3 D 1229-1298  H-Bb H-Mj S-Bb L-Bb 
1p3f X-ray 2.9 H 1428-1498  H-Bb S-Bb L-Bb 
1p3f X-ray 2.9 D 1232-1298  H-Bb S-Bb L-Bb 
1p3g X-ray 2.7 H 1431-1498  H-Bb S-Bb L-Bb 
1p3g X-ray 2.7 D 1230-1298  H-Bb H-Mj S-Bb L-Bb 
1p3i X-ray 2.3 H 1429-1498  H-Bb S-Bb L-Bb 
1p3i X-ray 2.3 D 1228-1298  H-Bb S-Bb L-Bb L-Mn 
1p3k X-ray 2.9 D 1231-1298  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 H 1429-1498  H-Bb S-Bb L-Bb 
1p3l X-ray 2.4 D 1231-1298  H-Bb S-Bb L-Bb 
1p3l X-ray 2.4 H 1428-1498  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 D 1231-1298  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 H 1432-1498  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 H 1431-1498  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 D 1231-1298  H-Bb S-Bb L-Bb 
1p3p X-ray 2.7 H 1427-1498  H-Bb S-Bb L-Bb 
1p3p X-ray 2.7 D 1230-1298  H-Bb S-Bb L-Bb 
4j8u X-ray 2.38 H 28-98 None
4j8u X-ray 2.38 D 28-98 None
6tda X-ray 15 D 30-98  H-Bb S-Bb L-Bb 
6tda X-ray 15 H 30-98  H-Bb S-Bb L-Bb 
6px1 X-ray 3.3 H 26-98  H-Bb S-Bb L-Bb 
6px1 X-ray 3.3 D 26-98  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 H 32-101  S-Bb L-Bb L-Mj 
6om3 X-ray 3.3 D 32-101  H-Bb S-Bb L-Bb L-Mn 
6om3 X-ray 3.3 T 32-101  H-Bb L-Bb L-Mn 
6om3 X-ray 3.3 P 32-101  H-Bb S-Bb L-Bb L-Mn 
6nqa X-ray 3.54 D 33-101  H-Bb S-Bb L-Bb 
6nqa X-ray 3.54 H 32-101  H-Bb S-Bb L-Bb 
4j8w X-ray 2.41 H 28-98 None
4j8w X-ray 2.41 D 28-98 None
5x0y X-ray 4.69 H 29-98  H-Bb S-Bb L-Bb 
5x0y X-ray 4.69 D 29-98  H-Bb S-Bb L-Bb 
6j99 X-ray 4.1 H 28-98  H-Bb H-Mj S-Bb L-Bb 
6j99 X-ray 4.1 D 27-98  H-Bb L-Bb L-Mn 
6s01 X-ray 3.2 H 29-98 None
6s01 X-ray 3.2 D 29-98 None
6tem X-ray 3.9 H 29-98 None
6tem X-ray 3.9 D 28-98 None
5x0x X-ray 3.97 H 29-98  H-Bb L-Bb 
5x0x X-ray 3.97 D 29-98  H-Bb L-Bb 
6kiw X-ray 4 H 29-98  H-Bb S-Bb L-Bb 
6kiw X-ray 4 D 29-98  H-Bb L-Bb L-Mn 
5z3v X-ray 4.22 D 29-98  H-Bb L-Bb 
5z3v X-ray 4.22 H 29-98  H-Bb L-Bb 
6nzo X-ray 3.8 H 26-98  H-Bb S-Bb L-Bb 
6nzo X-ray 3.8 D 26-98  H-Bb S-Bb L-Bb L-Mn 
6jma X-ray 6.8 H 29-98 None
6jma X-ray 6.8 D 29-98 None
6kiv X-ray 4 H 28-98  H-Bb L-Bb 
6kiv X-ray 4 D 27-98  H-Bb L-Bb 
5z3l X-ray 4.31 H 29-98  H-Bb H-Mj L-Bb 
5z3l X-ray 4.31 D 29-98  H-Bb H-Mj L-Bb 
7at8 X-ray 4.4 K 29-98 None
7at8 X-ray 4.4 G 28-98 None
7crr X-ray 3.48 D 27-98  H-Bb L-Bb 
7crr X-ray 3.48 H 25-98  H-Bb L-Bb L-Mn 
7crq X-ray 3.15 D 27-98  H-Bb L-Bb 
7crq X-ray 3.15 H 25-98  H-Bb S-Bb L-Bb L-Mn 
6wz9 X-ray 2.8 D 29-98 None
6wz9 X-ray 2.8 H 29-98 None
7cro X-ray 3.75 D 27-98  H-Bb 
7cro X-ray 3.75 H 25-98  H-Bb L-Bb 
6wz5 X-ray 2.2 D 25-98 None
6wz5 X-ray 2.2 H 25-98 None
6nj9 X-ray 2.96 D 30-101  H-Bb S-Bb L-Bb 
6nj9 X-ray 2.96 H 30-101  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text