Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P02281
RecName: Histone H2B 1.1
Begin-End: 41-102
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
YVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVR
LL
Structures of the domain P02281 41-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fq6 X-ray 4 H 33-98 None
6ltj X-ray 3.7 D 33-98  H-Bb 
3kxb X-ray 3.2 D 37-98 None
4ld9 X-ray 3.31 D 38-102 None
6esg X-ray 5.4 H 33-98 None
6esg X-ray 5.4 D 33-98 None
6fq8 X-ray 4.8 D 33-98 None
6fq8 X-ray 4.8 H 33-98 None
6esh X-ray 5.1 H 33-98 None


© NPIDB team 2003 - 2021

text