Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P02283
RecName: Histone H2B
Begin-End: 30-99
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
KRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITS
REIQTAVRLL
Structures of the domain P02283 30-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nqb X-ray 2.3 H 1429-1498  H-Bb S-Bb L-Bb 
2nqb X-ray 2.3 D 1228-1298  H-Bb S-Bb L-Bb L-Mn 
2pyo X-ray 2.43 H 28-98 None
2pyo X-ray 2.43 D 28-98 None
5wcu X-ray 5.53 R 29-98  H-Bb S-Bb L-Bb L-Mj 
5wcu X-ray 5.53 N 28-98  S-Bb L-Bb L-Mn 
5wcu X-ray 5.53 H 29-98  H-Bb H-Mj S-Bb L-Bb 
5wcu X-ray 5.53 D 28-98  H-Bb H-Mj S-Bb L-Bb L-Mn 
4x23 X-ray 3.5 H 32-98  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 D 32-98  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 R 32-98  H-Bb H-Mj S-Bb L-Bb 
4x23 X-ray 3.5 N 32-98  H-Bb S-Bb L-Bb 
4qlc X-ray 3.5 D 29-98  H-Bb H-Mj S-Bb L-Bb 
4qlc X-ray 3.5 H 28-98  H-Bb S-Bb L-Bb 
6dzt X-ray 2.99 H 28-98  H-Bb S-Bb L-Bb L-Mn 
6dzt X-ray 2.99 D 28-98  H-Bb S-Bb L-Bb 
6pwe X-ray 3.95 H 28-98 None
6pwe X-ray 3.95 D 28-98 None
6pwf X-ray 4.07 H 28-98 None
6pwf X-ray 4.07 D 30-98 None


© NPIDB team 2003 - 2021

text