Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: P02309
RecName: Histone H4
Begin-End: 25-99
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTS
LDVVYALKRQGRTLY
Structures of the domain P02309 25-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gej X-ray 3.6 C 25-98 None
6gej X-ray 3.6 D 25-98 None
1id3 X-ray 3.1 B 26-98  H-Bb S-Bb L-Bb 
6qld X-ray 4.15 f 27-99 None
6qld X-ray 4.15 b 27-99 None
6gen X-ray 3.6 C 25-98 None
6gen X-ray 3.6 D 25-98 None


© NPIDB team 2003 - 2021

text