Pfam domain
Pfam family: Ribosomal_S6 (PF01250.19)
Uniprot AC: P02358
RecName: 30S ribosomal protein S6
Begin-End: 3-91
Organism: Escherichia coli
Interaction Mode:   

Sequence:
HYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLM
NVEAPQEVIDELETTFRFNDAVIRSMVMR
Structures of the domain P02358 3-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3iy8 X-ray 14.1 F 3-91 None
5no3 X-ray 5.16 F 3-91 None
5no4 X-ray 5.16 F 3-91 None
6w7w X-ray 3.9 E 3-91 None
2ykr X-ray 9.8 F 3-91 None
5no2 X-ray 5.16 F 3-91 None
4a2i X-ray 16.5 F 3-91 None
4adv X-ray 13.5 F 3-91 None
5my1 X-ray 7.6 F 3-91 None
5me0 X-ray 13.5 F 3-91 None
5me1 X-ray 13.5 F 3-91 None
6xe0 X-ray 6.8 E 3-91 None
5uz4 X-ray 5.8 F 3-91 None
6nqb X-ray 3.8 F 30-91 None
6w7m X-ray 3.8 F 3-91 None
6w77 X-ray 3.6 F 3-91 None
6w6k X-ray 3.6 F 13-91 None


© NPIDB team 2003 - 2021

text