Pfam domain
Pfam family: Ribosomal_L27A (PF00828.21)
Uniprot AC: P02413
RecName: 50S ribosomal protein L15
Begin-End: 27-143
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LGKTGGRGHKGQKSRSGGGVRRGFEGGQMPLYRRLPKFGFTSRKAAITAEIRLSDLAKVE
GGVVDLNTLKAANIIGIQIEFAKVILAGEVTTPVTVRGLRVTKGARAAIEAAGGKIE
Structures of the domain P02413 27-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pc7 X-ray 2.5 L 27-143 None
6pct X-ray 2.8 L 27-143 None
5aka X-ray 5.7 L 27-143 None
6gc6 X-ray 4.3 L 73-143 None
6pch X-ray 2.9 L 27-143 None
6pcs X-ray 2.8 L 27-143 None
6i0y X-ray 3.2 L 27-143 None
5gaf X-ray 4.3 M 27-143 None
6gbz X-ray 3.8 L 26-142 None
6gc4 X-ray 4.3 L 27-143 None
6ys3 X-ray 2.58 l 27-143 None
6pc8 X-ray 2.9 L 27-143 None
3j5l X-ray 6.6 L 27-143 None
3j7z X-ray 3.9 L 27-143 None
6s0k X-ray 3.1 M 27-143 None
6gc8 X-ray 3.8 L 27-143 None
5gae X-ray 3.33 M 27-143 None
4csu X-ray 5.5 L 27-143 None
3j8g X-ray 5 L 27-143 None
7bv8 X-ray 3.14 M 27-143 None
6xz7 X-ray 2.1 L 27-143 None
5gag X-ray 3.8 M 27-143 None
5ady X-ray 4.5 L 27-143 None
4uy8 X-ray 3.8 L 27-143 None
2rdo X-ray 9.1 L 27-143 None
6gc0 X-ray 3.8 L 27-143 None
3bbx X-ray 10 L 27-143 None
2j28 X-ray 8 L 27-143 None
5gah X-ray 3.8 M 27-143 None
5gad X-ray 3.7 M 27-143 None
6qul X-ray 3 M 27-143 None
6wnt X-ray 3.1 l 27-143 None
6gc7 X-ray 4.3 L 73-143 None
6pc5 X-ray 2.7 L 27-143 None
6pcq X-ray 2.6 L 27-143 None
6pcr X-ray 2.5 L 27-143 None
6qdw X-ray 2.83 l 27-143 None
6pc6 X-ray 2.5 L 27-143 None
6wyv X-ray 2.75 L 27-143 None


© NPIDB team 2003 - 2021

text