Pfam domain
Pfam family: SASP (PF00269.22)
Uniprot AC: P02958
RecName: Small, acid-soluble spore protein C
Begin-End: 13-67
Organism: Bacillus subtilis
Interaction Mode:  H-Bb H-Mn L-Bb 

Sequence:
NDLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNM
Structures of the domain P02958 13-67
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2z3x X-ray 2.1 C 2-56  H-Bb H-Mn L-Bb 
2z3x X-ray 2.1 A 2-56  H-Bb H-Mn L-Bb 
2z3x X-ray 2.1 B 2-56  H-Bb H-Mn L-Bb 


© NPIDB team 2003 - 2021

text