Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: P03007
RecName: DNA polymerase III subunit epsilon
Begin-End: 9-175
Organism: Escherichia coli
Interaction Mode:   

Sequence:
IVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGI
ADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVT
DSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVY
Structures of the domain P03007 9-175
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fkw X-ray 7.3 D 9-175 None
5m1s X-ray 6.7 D 9-175  L-Bb 
5fkv X-ray 8 D 9-175 None


© NPIDB team 2003 - 2021

text