Pfam domain
Pfam family: Resolvase (PF00239.23)
Uniprot AC: P03015
RecName: Serine recombinase gin
Begin-End: 2-136
Organism: Escherichia phage Mu
Interaction Mode:   

Sequence:
LIGYVRVSTNDQNTDLQRNALVCAGCEQIFEDKLSGTRTDRPGLKRALKRLQKGDTLVVW
KLDRLGRSMKHLISLVGELRERGINFRSLTDSIDTSSPMGRFFFHVMGALAEMERELIIE
RTMAGLAAARNKGRI
Structures of the domain P03015 2-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4m6f X-ray 4.99 A 2-136 None


© NPIDB team 2003 - 2021

text