Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: P03034
RecName: Repressor protein cI
Begin-End: 22-77
Organism: Escherichia phage lambda
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
IYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF
Structures of the domain P03034 22-77
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3bdn X-ray 3.91 A 21-76  H-Bb H-Mj L-Bb L-Mj 
3bdn X-ray 3.91 B 21-76  L-Bb L-Mj 
1lmb X-ray 1.8 4 21-76  H-Bb H-Mj L-Bb L-Mj 
1lmb X-ray 1.8 3 21-76  H-Bb H-Mj L-Bb L-Mj 
1rio X-ray 2.3 B 22-77  H-Bb H-Mj L-Bb L-Mj 
1rio X-ray 2.3 A 22-77  H-Bb H-Mj L-Bb L-Mj 
1lli X-ray 2.1 B 21-76  H-Bb H-Mj L-Bb L-Mj 
1lli X-ray 2.1 A 21-76  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text