Pfam domain
Pfam family: N36 (PF11438.10)
Uniprot AC: P03045
RecName: Antitermination protein N
Begin-End: 2-36
Organism: Escherichia phage lambda
Interaction Mode:   

Sequence:
DAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRP
Structures of the domain P03045 2-36
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1qfq NMR B 2-36 None
5ms0 X-ray 9.8 N 2-36 None
5lm7 X-ray 3.35 N 2-36 None
5lm7 X-ray 3.35 F 2-36 None
6gov X-ray 3.7 N 2-36 None


© NPIDB team 2003 - 2021

text