Pfam domain
Pfam family: T_Ag_DNA_bind (PF02217.18)
Uniprot AC: P03070
RecName: Large T antigen
Begin-End: 136-229
Organism: Simian virus 40
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
KDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNIL
FFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKE
Structures of the domain P03070 136-229
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5d9i X-ray 1.7 B 136-229 None
5d9i X-ray 1.7 A 136-229  S-Bb L-Bb L-Mj 
4fgn X-ray 3.2 B 136-229  H-Bb S-Bb S-Mj L-Bb L-Mj 
4fgn X-ray 3.2 A 136-229  H-Bb S-Bb L-Bb L-Mj 
4gdf X-ray 2.8 E 136-229  H-Bb S-Bb L-Bb L-Mj 
4gdf X-ray 2.8 F 136-229  H-Bb S-Bb S-Mj L-Bb L-Mj 
4gdf X-ray 2.8 B 136-229  H-Bb S-Bb S-Mj L-Bb L-Mj 
4gdf X-ray 2.8 A 136-229  H-Bb S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text