Pfam domain
Pfam family: Polyoma_lg_T_C (PF06431.13)
Uniprot AC: P03070
RecName: Large T antigen
Begin-End: 265-627
Organism: Simian virus 40
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
TKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHEKHYANA
AIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADI
EEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCG
GKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGS
VKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQARFVKQIDFRAKDYLKHCLERSEFLL
EKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIG
VLD
Structures of the domain P03070 265-627
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4gdf X-ray 2.8 F 265-627  L-Bb 
4gdf X-ray 2.8 E 265-627  H-Bb H-Mj L-Bb 
4gdf X-ray 2.8 B 265-627  L-Bb 
4gdf X-ray 2.8 A 265-627  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text