Pfam domain
Pfam family: IN_DBD_C (PF00552.23)
Uniprot AC: P03354
RecName: Gag-Pol polyprotein
Begin-End: 1508-1547
Organism: Rous sarcoma virus
Interaction Mode:   

Sequence:
IETGEWEKGWNVLVWGRGYAAVKNRDTDKVIWVPSRKVKP
Structures of the domain P03354 1508-1547
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ejk X-ray 3.8 H 227-267  S-Bb L-Bb 
5ejk X-ray 3.8 F 227-267 None
5ejk X-ray 3.8 G 227-267 None
5ejk X-ray 3.8 E 227-267  S-Bb L-Mj 
5ejk X-ray 3.8 D 227-267  L-Bb 
5ejk X-ray 3.8 C 227-267 None
5ejk X-ray 3.8 B 227-267 None
5ejk X-ray 3.8 A 227-267  L-Mj 


© NPIDB team 2003 - 2021

text