Pfam domain
Pfam family: IN_DBD_C (PF00552.23)
Uniprot AC: P03365
RecName: Gag-Pro-Pol polyprotein
Begin-End: 1655-1700
Organism: Mouse mammary tumor virus
Interaction Mode:   

Sequence:
VMWKDLLTGSWKGPDVLITAGRGYACVFPQDAETPIWVPDRFIRPF
Structures of the domain P03365 1655-1700
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jca X-ray 4.8 G 219-264  H-Bb S-Bb 
3jca X-ray 4.8 H 219-264 None
3jca X-ray 4.8 F 219-264 None
3jca X-ray 4.8 E 219-264  H-Bb S-Bb L-Mj 
3jca X-ray 4.8 D 219-264  H-Bb 
3jca X-ray 4.8 C 219-264  H-Bb S-Bb 
3jca X-ray 4.8 B 219-264 None
3jca X-ray 4.8 A 219-264  H-Bb S-Bb L-Mj 


© NPIDB team 2003 - 2021

text