Pfam domain
Pfam family: RNase_H (PF00075.26)
Uniprot AC: P03366
RecName: Gag-Pol polyprotein
Begin-End: 1035-1144
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate BH10)
Interaction Mode:   

Sequence:
GAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNI
VTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Structures of the domain P03366 1035-1144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4pqu X-ray 2.51 A 436-545 None
4pqu X-ray 2.51 C 436-545 None


© NPIDB team 2003 - 2021

text