Pfam domain
Pfam family: RNase_H (PF00075.26)
Uniprot AC: P03366
RecName: Gag-Pol polyprotein
Begin-End: 1035-1153
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate BH10)
Interaction Mode:  H-Bb H-Mn L-Bb L-Mn 

Sequence:
GAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNI
VTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Structures of the domain P03366 1035-1153
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rtd X-ray 3.2 C 436-554  H-Bb H-Mn L-Bb L-Mn 
1rtd X-ray 3.2 A 436-554  H-Bb L-Bb L-Mn 
6asw X-ray 2.61 A 436-553  H-Bb L-Bb 
6asw X-ray 2.61 C 436-553  H-Bb L-Bb 
5txo X-ray 2.55 A 436-554  H-Bb L-Bb 
5txo X-ray 2.55 C 436-554  H-Bb L-Bb L-Mn 
2hmi X-ray 2.8 A 436-557  L-Bb 
3klh X-ray 2.9 A 436-557  H-Bb L-Bb 
1t05 X-ray 3 A 436-554  H-Bb 
6an8 X-ray 2.6 A 436-553  H-Bb H-Mn L-Bb 
6an8 X-ray 2.6 C 436-553  H-Bb L-Bb L-Mn 
3klf X-ray 3.15 M 436-554  H-Bb L-Bb 
3klf X-ray 3.15 A 436-554  H-Bb L-Bb 
3klf X-ray 3.15 E 436-554  H-Bb L-Bb L-Mn 
3klf X-ray 3.15 I 436-554  H-Bb L-Bb 
4r5p X-ray 2.89 A 436-554  H-Bb L-Bb L-Mn 
4r5p X-ray 2.89 C 436-554  H-Bb L-Bb L-Mn 
1hvu X-ray 4.75 J 436-554 None
1hvu X-ray 4.75 G 436-554 None
1hvu X-ray 4.75 D 436-554 None
1hvu X-ray 4.75 A 436-554 None
3jyt X-ray 3.3 A 436-554  H-Bb L-Mn 
3klg X-ray 3.65 E 436-554  H-Bb L-Bb 
3klg X-ray 3.65 A 436-554  H-Bb L-Bb 
1t03 X-ray 3.1 A 436-557  H-Bb L-Bb L-Mn 
5txl X-ray 2.5 C 436-554  H-Bb L-Bb 
5txl X-ray 2.5 A 436-554  H-Bb L-Bb 
6o9e X-ray 2.4 C 436-553  H-Bb L-Bb 
6o9e X-ray 2.4 A 436-553  H-Bb L-Bb 
6hak X-ray 3.95 C 436-553 None
6hak X-ray 3.95 A 436-553 None
6an2 X-ray 2.7 A 436-553  H-Bb L-Bb 
6an2 X-ray 2.7 C 436-553  H-Bb L-Bb 
3jsm X-ray 3 A 436-554  H-Bb L-Bb L-Mn 
5txm X-ray 2.7 A 436-554  H-Bb L-Bb 
5txm X-ray 2.7 C 436-554  H-Bb L-Bb 
5hro X-ray 2.75 A 436-554  H-Bb L-Bb 
5hro X-ray 2.75 C 436-554  H-Bb L-Bb 
6oun X-ray 2.66 A 436-555  H-Bb L-Bb 
5i42 X-ray 3.3 A 436-554  H-Bb L-Bb 
5i42 X-ray 3.3 C 436-554  H-Bb L-Bb 
5txn X-ray 2.55 A 436-554  H-Bb L-Bb L-Mn 
5txn X-ray 2.55 C 436-554  H-Bb L-Bb 
4puo X-ray 2.9 A 436-554 None
4puo X-ray 2.9 C 436-554 None
4q0b X-ray 3.3 A 436-554 None
4q0b X-ray 3.3 C 436-554 None
5i3u X-ray 3 C 436-553  H-Bb L-Bb 
5i3u X-ray 3 A 436-553  H-Bb L-Bb 
4pwd X-ray 3 A 436-554 None
4pwd X-ray 3 C 436-554 None
3v81 X-ray 2.85 C 436-554  H-Bb L-Bb 
3v81 X-ray 2.85 A 436-554  H-Bb L-Bb L-Mn 
5hlf X-ray 2.95 A 436-554  H-Bb L-Bb 
5hlf X-ray 2.95 C 436-553  H-Bb L-Bb 
6waz X-ray 4.1 A 436-557 None
5txp X-ray 2.7 C 436-554  H-Bb L-Bb 
5txp X-ray 2.7 A 436-554  H-Bb L-Bb L-Mn 
3v4i X-ray 2.8 C 436-554  H-Bb L-Bb 
3v4i X-ray 2.8 A 436-554  H-Bb L-Bb 
5hp1 X-ray 2.9 C 436-553  H-Bb L-Bb 
5hp1 X-ray 2.9 A 436-553  H-Bb L-Bb 
6amo X-ray 2.5 C 436-553  H-Bb L-Bb L-Mn 
6amo X-ray 2.5 A 436-553  H-Bb L-Bb 
3kle X-ray 3.2 A 436-557  H-Bb L-Bb L-Mn 
3kle X-ray 3.2 E 436-557  H-Bb L-Bb L-Mn 
3kle X-ray 3.2 I 436-557  H-Bb L-Bb L-Mn 
3kle X-ray 3.2 M 436-557  H-Bb L-Bb L-Mn 
6avm X-ray 2.5 C 436-553  H-Bb L-Bb 
6avm X-ray 2.5 A 436-553  H-Bb L-Bb L-Mn 
3v6d X-ray 2.7 C 436-554  H-Bb L-Bb 
3v6d X-ray 2.7 A 436-554  H-Bb L-Bb 
1r0a X-ray 2.8 A 436-557  H-Bb L-Bb L-Mn 
1hys X-ray 3 A 436-553 None
1j5o X-ray 3.5 A 436-557  H-Bb L-Bb 
1n5y X-ray 3.1 A 436-557  H-Bb H-Mn 
1n6q X-ray 3 A 436-557  H-Bb 
5d3g X-ray 2.3 A 436-553  H-Bb L-Bb 
5d3g X-ray 2.3 C 436-553  H-Bb L-Bb 
6bhj X-ray 2.81 A 436-554 None
6bhj X-ray 2.81 C 436-553 None
6b19 X-ray 4.5 A 433-554 None
6wb1 X-ray 4.7 A 436-557 None
6anq X-ray 2.59 A 436-553  H-Bb H-Mn L-Bb 
6anq X-ray 2.59 C 436-553  H-Bb L-Bb 
6avt X-ray 2.6 C 436-553  H-Bb L-Bb 
6avt X-ray 2.6 A 436-553  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text